306 Xinsha Road, Shajing Street, Bao'an District,Shenzhen, Guangdong, China
Nhà Sản phẩmPeptide Steroids

Polypeptide Hormone Sermorelin 2mg CAS 86168-78-7 dùng cho chẩn đoán sử dụng chất gây nghiện

Polypeptide Hormone Sermorelin 2mg CAS 86168-78-7 dùng cho chẩn đoán sử dụng chất gây nghiện

    • Polypeptide Hormone Sermorelin 2mg CAS 86168-78-7 for Diagnostic Agent Usage
    • Polypeptide Hormone Sermorelin 2mg CAS 86168-78-7 for Diagnostic Agent Usage
  • Polypeptide Hormone Sermorelin 2mg CAS 86168-78-7 for Diagnostic Agent Usage

    Thông tin chi tiết sản phẩm:

    Nguồn gốc: Trung Quốc
    Hàng hiệu: Sendi
    Chứng nhận: +8618578209860
    Số mô hình: ycwlb045@yccreate.com

    Thanh toán:

    Số lượng đặt hàng tối thiểu: 10vials
    Giá bán: USD1-10/vial
    chi tiết đóng gói: đóng gói kín đáo
    Thời gian giao hàng: 5-7 ngày tới cửa nhà bạn
    Điều khoản thanh toán: Chuyển khoản ngân hàng, Western Union, Bitcoin.
    Khả năng cung cấp: 50000000vials / tháng
    Liên hệ với bây giờ
    Chi tiết sản phẩm
    CAS: 86168-78-7 MF: C149H246N44O42S
    MW: 3357,88 Đặc điểm kỹ thuật: 2mg
    Thời gian giao hàng: Trong vòng 24 giờ đóng gói: Gói ẩn
    Thanh toán: Ngân hàng / WU / Bitcoin WhatsApp: 8618578209860

    Polypeptide Hormone Sermorelin 2mg CAS 86168-78-7 dùng cho chẩn đoán sử dụng chất gây nghiện

    Tên sản phẩm: Sermorelin
    Từ đồng nghĩa SERMORELIN SERMORELIN ACETATE YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2; TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG -LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2; TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY -GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2 CON NGƯỜI, H-TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN- (ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2), tác nhân phóng thích tăng trưởng HORMONE (1 -29), AMIDE, HUMAN, GRF (1-29) AMIDE (CON NGƯỜI)
    CAS: 86168-78-7
    MF: C149H246N44O42S
    MW: 3357,88
    Sử dụng chất ức chế xanthine oxidase

    Hồ sơ Sermorelin

    Sermorelin Acetate, còn được gọi là GRF 1-29, là Hormone Kích thích Hormon tăng trưởng (GHRH) sản xuất bởi não giúp kích thích sản xuất và giải phóng Hormon Tăng trưởng (GH). Sermorelin Acetate được phát triển lần đầu tiên vào những năm 70, được coi là đoạn ngắn nhất chức năng của GHRH và đã được sử dụng làm kiểm tra sự bài tiết Hormone tăng trưởng. Nó thường được sử dụng rộng rãi trong liệu pháp chống lão hóa cùng với Testosterone ở nam giới. Sermorelin Acetate ảnh hưởng đến một nguồn thất bại chính trong trục thần kinh GH, có hoạt động sinh lý nhiều hơn, và việc sử dụng hormone người trưởng thành không bị hạn chế. So với Hormon tăng trưởng của con người (hGH), Sermorelin Acetate là một chất kích thích tố kích thích tố tăng trưởng, có nghĩa là nó kích thích tuyến yên để sản xuất và tiết ra hormone tăng trưởng. Ngoài ra, Sermorelin Acetate và Modified GRF 1-29 chứa 29 axit amin trong khi hGH là một phân tử lớn chứa 191 axit amin.

    Peptide Sermorelin Acetate và HGH

    Sermorelin Acetate, có cấu trúc tương tự như CJC-1295, là một hoocmon tổng hợp giống hệt sinh học, cực kỳ hiệu quả trong việc tăng lượng HGH. Hormone Tăng trưởng của Con người là một hoóc môn được phát hành bởi cơ thể điều khiển sự sinh sản và sự phát triển của tế bào và mỗi cơ quan trong cơ thể. Khi còn trẻ, sản xuất HGH của cơ thể hoạt động mạnh nhất trong khi tốc độ tăng trưởng ở điểm cao nhất. Sau 30 tuổi, trong mỗi thập niên của cuộc đời, giảm 14% lượng HGH. Vào tuổi 40, sản xuất HGH khoảng 40% trong số đó là ở tuổi 20. Với sự phát triển hơn nữa của các yếu tố kích thích phát triển nội tiết (GHRF), chẳng hạn như Sửa đổi GRF 1-29, sản xuất HGH có thể sẽ bắt đầu lại bằng kích thích tuyến yên.

    Chuỗi peptit:

    Chất peptide
    MGF, 2mg
    PEG MGF, 2mg
    CJC-1295 DAC, 2mg
    CJC-1295, 2mg
    PT141, 10mg
    Melanotan-2, 10mg
    GHRP-2, 10mg
    GHRP-6, 10mg
    GHRP-2, 5 mg
    GHRP-6, 5 mg
    Ipamorelin, 2mg
    Hexarelin, 2mg
    Sermorelin, 2mg
    Oxytocin, 2mg
    TB500, 2mg
    HGH 176-191, 2mg
    Triptorelin, 2mg
    Tesamorelin, 2mg
    Gonadorelin, 2mg
    Gonadorelin, 10mg
    DSIP, 2mg
    Selank, 5mg
    BPC 157, 2mg
    Epitalon, 10mg
    Follistatin 344, 1mg
    AOD-9604, 2mg
    Deslorelin, 20mg

    Chi tiết liên lạc
    Shenzhen Sendi Biotechnology Co.Ltd.

    Người liên hệ: Ivy Young

    Gửi yêu cầu thông tin của bạn trực tiếp cho chúng tôi (0 / 3000)

    Sản phẩm khác